| PDBID: | 9mvs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mv0 | | Status: | HPUB -- hold until publication | | Title: | Structure of HKU5 spike C-terminal domain in complex with ACE2 from Pipistrellus abramus | | Authors: | Li, N., Tsybovsky, Y., Teng, I., Zhou, T. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvg | | Status: | HPUB -- hold until publication | | Title: | Structure of SciW variant L66A bound to the Rhs1 transmembrane domain | | Authors: | Van Schepdael, M.A., Prehna, G. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvj | | Status: | HPUB -- hold until publication | | Title: | anti-EGFR designed Fab | | Authors: | Kiefer, J.R., Frey, N.C., Alberstein, R.G., Seeger, F., Watkins, A.M., Gligorijevic, V., Dou, Y., Tang, Y., Regev, A., Bonneau, R. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mvl | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of feline coronavirus UU23 main protease with GC376 | | Authors: | Shaqra, A.M., Maryam, A., Schiffer, C.A. | | Deposition date: | 2025-01-15 |
|
| PDBID: | 9mur | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rubisco from Arabidopsis thaliana with the 2B small subunit isoform | | Authors: | Ceminsky, M., Askey, B., Gunn, L.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9muq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i07 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glycerldeyde-3-phosphate dehydrogenase hexadecamer (major conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i06 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glyceraldehyde-3-phosphate dehydrogenase (minor conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i0a | | Status: | HOLD -- hold until a certain date | | Title: | CARM1 in complex with arg-aDMA analog | | Authors: | Cura, V., Dursun, E., Troffer, N., Cavarelli, J. | | Deposition date: | 2025-01-14 | | Release date: | 2026-01-14 |
|
| PDBID: | 9i0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzm | | Status: | HPUB -- hold until publication | | Title: | 235 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzn | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzo | | Status: | HPUB -- hold until publication | | Title: | 270 A C1 SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzq | | Status: | HPUB -- hold until publication | | Title: | 280 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzr | | Status: | HPUB -- hold until publication | | Title: | 290 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzt | | Status: | HPUB -- hold until publication | | Title: | 215 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzu | | Status: | HPUB -- hold until publication | | Title: | 235 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzv | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzw | | Status: | HPUB -- hold until publication | | Title: | 270 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzx | | Status: | HPUB -- hold until publication | | Title: | 280 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzy | | Status: | HPUB -- hold until publication | | Title: | 290 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
