| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be9 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env 16055 dGly4 NFL | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bec | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bej | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9ezs | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of free hNQO1 unmixed (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezt | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH for 1190ms (P4502) | | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9ezw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z39 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z2z | | Status: | HPUB -- hold until publication | | Title: | PRMT1-Tetramer | | Authors: | Nadendla, E.K., Wang, C.H., Ho, M.C. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z30 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HOIP PUB domain in complex with tolfenamic acid complex | | Authors: | Zhong, F., Ruan, K. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z33 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z36 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HOIP PUB domain in complex with sertraline complex | | Authors: | Zhong, F., Ruan, K. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z34 | | Status: | HPUB -- hold until publication | | Title: | Structure of the USP11 deubiquitinase domain | | Authors: | Zhao, Z., Gao, Y., An, Y., Lan, H. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z37 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human STING ligand binding domain. | | Authors: | Sun, P.K., Li, X.J. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 9be5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
