PDBID: | 8qx4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-22 |
|
PDBID: | 8wv1 | Status: | HPUB -- hold until publication | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | Authors: | DeMirci, H., Tosun, B. | Deposition date: | 2023-10-22 |
|
PDBID: | 8wv2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-22 | Sequence: | >Entity 1 MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
PDBID: | 8wv0 | Status: | HPUB -- hold until publication | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | Deposition date: | 2023-10-22 |
|
PDBID: | 8wuz | Status: | HPUB -- hold until publication | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | Deposition date: | 2023-10-22 |
|
PDBID: | 8qx3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-21 |
|
PDBID: | 8up5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-21 | Release date: | 2025-04-20 |
|
PDBID: | 8wur | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | Deposition date: | 2023-10-21 | Release date: | 2024-10-21 |
|
PDBID: | 8qx1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-20 |
|
PDBID: | 8uot | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-10-20 |
|
PDBID: | 8uoq | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-10-20 |
|
PDBID: | 8uom | Status: | HPUB -- hold until publication | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3dimeK4 histone tail | Authors: | Caroli, J., Mattevi, A. | Deposition date: | 2023-10-20 |
|
PDBID: | 8uon | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-20 | Release date: | 2025-04-19 |
|
PDBID: | 8up4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-20 |
|
PDBID: | 8wu9 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human canonical nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2023-10-20 | Release date: | 2025-04-20 |
|
PDBID: | 8wub | Status: | HPUB -- hold until publication | Title: | The X-ray structure of human neuroglobin C120S mutant | Authors: | Lin, Y.W., Yuan, H. | Deposition date: | 2023-10-20 |
|
PDBID: | 8wuh | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of A. thaliana canonical H2A.13 nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2023-10-20 | Release date: | 2025-04-20 |
|
PDBID: | 8wuj | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2023-10-20 | Release date: | 2025-04-20 |
|
PDBID: | 8qw8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 | Release date: | 2025-04-19 |
|
PDBID: | 8qw9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 | Release date: | 2025-04-19 |
|
PDBID: | 8qwc | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 | Release date: | 2025-04-23 |
|
PDBID: | 8qwj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of GFP variant | Authors: | Lenz, M., Fiedler, M., Bellini, D., Chin, J.W. | Deposition date: | 2023-10-19 |
|
PDBID: | 8uoh | Status: | HPUB -- hold until publication | Title: | Crystal structure of human NUAK1-MARK3 kinase domain chimera bound with small molecule inhibitor #10 | Authors: | Delker, S.L., Abendroth, J. | Deposition date: | 2023-10-19 |
|
PDBID: | 8uoj | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|
PDBID: | 8uoi | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-19 |
|