| PDBID: | 9eeq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with PALA, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Bhatt, N., Pei, X., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9een | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eed | | Status: | HPUB -- hold until publication | | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
SMSLAATAWQRLEALFHRACQLPAAEREAFARAQAGDDASLRDDLLAMLAVESQATLRVRAPLKQAVAALRAPLPELPAGTRFGAWAIDRLIGAGGMGQVYLGHRADGAYEREVAIKLVAADALDAQGRALFEFECRLLAQMVHPAIAQIHDVGTDAHGQPYLVAEYLRGEPITWWCDEHRLSLHARVLLMLRVGEAVQHAHQKGVIHRDLKPSNVLVSEIDGRPMPGVIDFGIAVDATNPGMTYAHDRGTPGYMSPEQARGAQDVDARSDIYALGAMFYELSCGLAPVAGRDGVPQPPSQRVAAVPADARARICAARATTYQKLHEQLRDGLDAIVLRALEPQPGARYASVSALLDDLHRWLD
|
|
| PDBID: | 9ef5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP2, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with three DILP5, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eef | | Status: | HPUB -- hold until publication | | Title: | Human Kv1.3 mutant - G427H | | Authors: | Selvakumar, P., Swartz, K.J. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with two DILP1, symmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9hg1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9hg0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9hg3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9hg2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9hfz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kmz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn0 | | Status: | HPUB -- hold until publication | | Title: | Bat MERSr-CoV NL140422 Nsp1 bound to the Human 40S Ribosomal subunit-State2 | | Authors: | Yuan, S., Yan, R., Wu, M. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn2 | | Status: | HPUB -- hold until publication | | Title: | Crystallization of zinc metalloproteinase PepO from Porphyromonas gingivalis | | Authors: | Feng, C.Y., Feng, C.Y. | | Deposition date: | 2024-11-18 | | Sequence: | >Entity 1
NKGQTNDTDRKREPVPAIDLSAMDTSVRPQDDFYRYCNGNWMKNNPLKPAYSRYGSFDILHDSTLERVHLIVDNLAAGQHEVGTNEYRIATLYRQAMDSIKRNKDGAAPLKEDLQKIEAIADRAAMVKYAAAKDNMGGSTFFGSYVYADAKNSEMNIFHITQTGLALDNRDYYLKQDAKSQQIREAYVAYLNKIAKLAGYDDEAATRIAKNAMKMETELAQICYSKEELRDTHRNYNKMAVKEFTNKYQGFDWTTYLADRQLTTLEEWDVEQLDFFKKFDSWFAKADLNEMRDYLLAGTISGAASYLSDDFEQARFDFFGKTLSGTTEMHPRWKRSVGMVSSFLGEALGEVYVKQYFPPEAKERMLKLVKNLQTALGERINMLTWMGDSTKMKAQEKLNSFIIKIGYPDKWKDYSKMEIKGDSYYADIKRASKWMHDDNMADLGKTVDRERWLMNPQDVNAYYNPTTNEICFPAAILQPPFFNMDADDAVNYGGIGVVIGHEMTHGFDDQGRNFDKDGNMINWWTAEDAQKFETTARKLADQFSEIYVADGVRANGNMTLGENIADQGGLLISYLAFRNAAKGEVMEEIDGFTPDQRFFIGYARLWGQNIRPEEVLRLTQIDVHSLGELRVNQALRNIEAFYEAFNIQPTDKMYLEPEKRVVVW
|
|
