| PDBID: | 8s79 | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s7e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s7d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution | | Authors: | Khoshouei, M., Goretzki, B. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s7b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yil | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yim | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yic | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yid | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Burkholderia ubonensis in complex with NADH and 6-methyl-2,3,4,5-tetrahydropyridine | | Authors: | Ma, Z.F., Shen, X.Y. | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 8yi8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yi9 | | Status: | HPUB -- hold until publication | | Title: | human PRPS2 isoform2 | | Authors: | Liu, J.L., Lu, G.M. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yih | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yio | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yii | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yia | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yij | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yin | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
