| PDBID: | 9jz9 | | Status: | HPUB -- hold until publication | | Title: | PfDXR - Mn2+ - MAMK218 ternary complex | | Authors: | Takada, S., Sakamoto, Y., Tanaka, N. | | Deposition date: | 2024-10-14 |
|
| PDBID: | 9dy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dy6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of PmHMGR bound to mevalonate, CoA and NAD 4 minutes after reaction initiation at pH 9 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dy7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Proteus vulgaris tryptophan indole-lyase complexed with L-ethionine and Na+ | | Authors: | Phillips, R.S. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dy4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of iron-bound human ADO C18S/C239S variant soaked in hydralazine at 2.39 Angstrom resolution | | Authors: | Liu, A., Li, J., Duan, R. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dy5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dya | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CHIP-TPR in complex with the Hsp70 tail | | Authors: | Zhang, H., Nix, J.C., Page, R.C. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dyb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CHIP-TPR in complex with the phosphorylated Hsp70 tail | | Authors: | Zhang, H., Nix, J.C., Page, R.C. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9dyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jz1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jz2 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9jz3 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 8 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9jz4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9jz5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 9 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9h2m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy1 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxz | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy2 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with 2''-Deoxyadenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxy | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with ADP | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy0 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Dimethyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with D-peptide | | Authors: | Kadam, R.U., Wilson, I.A. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Periplasmic Protein (PA5167) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-12 | | Sequence: | >Entity 1
SNAADPIVIKFSHVVAEHTPKGQGALLFKKLVEERLPGKVKVEVYPNSSLFGDGKE(MSE)EALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFDNIQAVDRFQQSPQGKELLTS(MSE)QDKGITGLGYWHNG(MSE)KQLSANKPLREPKDARGLKFRVQASKVLEEQFKAVRANPRK(MSE)SFAEVYQGLQTGVVNGTENPWSNIYSQK(MSE)HEVQKYITESDHGVLDY(MSE)VITNTKFWNGLPEDVRGVLAKT(MSE)DEVTVEVNKQAEALNQGDKQRIVEAKTSEIIELTPEQRAEWRKA(MSE)QPVWKKFEGEIGADLIKAAEAANQAQ
|
|
| PDBID: | 9jy5 | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA1 | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
