| PDBID: | 9csj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human glyoxalase domain-containing protein 4 (GLOD4) at 2.33 A resolution. | | Authors: | Griswold-Prenner, I., Dou, Y., Jennings, A., Kayser, F. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9css | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 spike protein Ecto-domain with internal tag, 1UP RBD conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9cta | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9cst | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTSGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9csu | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTYGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9csv | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor, oxidized by hydrogen peroxide | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTYGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9csw | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-S112A-K121Y bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTAGTTEANAWYSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9ct6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ctb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 spike protein Ecto-domain with internal tag, All RBD down conformation, State-3 | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ctd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g85 | | Status: | HPUB -- hold until publication | | Title: | Structure of Response regulator PleD in complex with c-diGMP and ppGpp | | Authors: | Jaboulay, C., Dugelay, C., Guzzo, M., Terradot, L. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g86 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of Response regulator PleD in complex with c-diGMP and pppGpp | | Authors: | Dugelay, C., Jaboulay, C., Guzzo, M., Terradot, L. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g8i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g8r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g8n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g8p | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-23 |
|
