| PDBID: | 9h6e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of Histidine-containing phosphotransfer 1 (AHP1) and Response regulator 1 (ARR1) from A. thaliana | | Authors: | Tran, L.H., Ruszkowski, M. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the E. coli F-plasmid VapBC toxin-antitoxin complex (VapB T3N) | | Authors: | Hollingshead, S., McVicker, G., Nielsen, M.R., Zhang, Y., Pilla, G., Jones, R.A., Thomas, J.C., Johansen, S.E.H., Exley, R.M., Brodersen, D.E., Tang, C.M. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the E. coli F-plasmid VapBC toxin-antitoxin complex (VapB V5E) | | Authors: | Hollingshead, S., McVicker, G., Nielsen, M.R., Zhang, Y., Pilla, G., Jones, R.A., Thomas, J.C., Johansen, S.E.H., Exley, R.M., Brodersen, D.E., Tang, C.M. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the E. coli F-plasmid VapBC toxin-antitoxin complex | | Authors: | Hollingshead, S., McVicker, G., Nielsen, M.R., Zhang, Y., Pilla, G., Jones, R.A., Thomas, J.C., Johansen, S.E.H., Exley, R.M., Brodersen, D.E., Tang, C.M. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the E. coli F-plasmid VapBC toxin-antitoxin complex (VapB T3N, A13P, L16R) | | Authors: | Hollingshead, S., McVicker, G., Nielsen, M.R., Zhang, Y., Pilla, G., Jones, R.A., Thomas, J.C., Johansen, S.E.H., Exley, R.M., Brodersen, D.E., Tang, C.M. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacteroides ovatus GH98 endoxylanase in complex with arabino-xylooligosaccharide | | Authors: | Tomlinson, C.W.E., Cartmell, A., Bolam, D. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacteroides ovatus GH98 endoxylanase in complex with arabino-xylooligosaccharide | | Authors: | Tomlinson, C.W.E., Cartmell, A., Bolam, D.N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacteroides ovatus GH98 endoxylanase with Seleno-methionine substituents | | Authors: | Tomlinson, C.W.E., Cartmell, A., Bolam, D.N. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9h6p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of NUDT14 complexed with novel compound AMNUDT14-003 in spacegroup P1 | | Authors: | Balikci, E., Koekemoer, L., Dlamini, L.S., Gurav, N., Apostolidou, M., Adcock, C., McGown, A., Marques, A.M.C., Spencer, J., Huber, K.V.M., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6j | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 Apo Structure | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h6o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Leishmania major ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6l | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 in Complex with UDP | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h6k | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 in Complex with UDP-GalNac | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9e4a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e43 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and Phosphonoacetate | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e4e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e44 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 2-Phosphonopropionic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e45 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 1-Hydroxypropylphosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e46 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxy-2-methylpropyl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e47 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxypropan-2-yl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
