| PDBID: | 9fd2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Pol II-TC-NER-STK19 complex | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Coxsackievirus A9 bound with compound 17 (CL301) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcv | | Status: | PROC -- to be processed | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcu | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIAHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGSC
|
|
| PDBID: | 9fct | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 9fcs | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHNLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RBBP9 with spacegroup p212121 | | Authors: | Gorrec, F., Bellini, D. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcq | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHALEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OPR3 loop swap variant L6(AchrOYE4) in complex with NADH4 | | Authors: | Bijelic, A., Kerschbaumer, B., Macheroux, P. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fco | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OPR3 loop swap variant L6(AchrOYE4) in complex with NADPH4 | | Authors: | Bijelic, A., Kerschbaumer, B., Macheroux, P. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-domain antibody binding the SARS-COV2 S2 | | Authors: | Vann Molle, I., Remaut, H. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcl | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16) in complex with SAM from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fck | | Status: | PROC -- to be processed | | Title: | 3D Cryo-EM reveals the structure of a 3-Fmoc zipper motif ensuring the self-assembly of tripeptide nanofiber | | Authors: | Estrozi, L.F., Jierry, L. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | USP1 bound to ML323 and ubiquitin conjugated to FANCD2 (ordered subset, focused refinement) | | Authors: | Rennie, M.L., Gundogdu, M., Walden, H. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fci | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | USP1 bound to KSQ-4279 and ubiquitin conjugated to FANCD2 (focused refinement) | | Authors: | Rennie, M.L., Gundogdu, M., Walden, H. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with PrFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with ProFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fce | | Status: | HPUB -- hold until publication | | Title: | BelI in complex with SAM from Streptomyces sp. UCK14 | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSAQTFEIKGNDLWDPTTFDALRRQLIPSFDLIYEAAVRTVAATVPTAPRVLDLGAGTGLLSAAILRELPDSEVVLVDRSELMLTQARGRFASQDGVTVQTGDLTDPLPEGGFDAVVSGLAIHHLSHTGKRDLFRRIREALRPGGVFVNVEQVQGPLPHLESLYDSQHELHVIREQAPAHEWAAGRERMKFDVCIDLETQLQWLRDAGFRSVDCLAKDFRFATYAGWVS
|
|
| PDBID: | 9fcd | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16) in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
