PDBID: | 9gc5 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | Authors: | Hargreaves, D. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gch | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human mitochondrial RNAseZ with tRNA-His-CCA | Authors: | Valentin Gese, G., Hallberg, B.M. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND8 | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc3 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc6 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | Authors: | Hargreaves, D. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C11H12N2O3 | Authors: | Borel, F., D''Auria, L. | Deposition date: | 2024-08-01 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
PDBID: | 9gc9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND27 | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gca | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C8H8N2O | Authors: | Borel, F., D''Auria, L. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcc | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND47 | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcf | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR CHF-6523 | Authors: | Pala, D., Bruno, P., Capelli, A.M., Biagetti, M. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcd | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH Fulacimstat (COMPOUND86) | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gci | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of beta-glucosidase from the thermophilic bacterium Caldicellulosiruptor saccharolyticus determined at 1.47 A resolution | Authors: | Chrysina, E.D., Sotiropoulou, A.I. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcj | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of beta-glucosidase from the thermophilic bacterium Caldicellulosiruptor saccharolyticus in complex with beta-D-glucose determined at 1.95 A resolution | Authors: | Chrysina, E.D., Sotiropoulou, A.I. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9izb | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of SARS-CoV-2 main protease in complex with TMP1 | Authors: | Deng, X.Y., Zeng, R., Yang, S.Y., Lei, J. | Deposition date: | 2024-08-01 |
|
PDBID: | 9izc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 | Release date: | 2025-08-01 |
|
PDBID: | 9izo | Status: | PROC -- to be processed | Title: | Apg mutant enzyme D336A of acarbose hydrolase from human gut flora K. grimontii TD1, complex with acarviosine | Authors: | Zhou, J.H., Huang, J.Y. | Deposition date: | 2024-08-01 |
|
PDBID: | 9ize | Status: | PROC -- to be processed | Title: | Apg mutant enzyme of Acarbose hydrolase D336A from human gut flora K. grimontii TD1, complex with Acarviosine-glucose | Authors: | Zhou, J.H., Huang, J.Y. | Deposition date: | 2024-08-01 |
|
PDBID: | 9izu | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izv | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izw | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izx | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9izf | Status: | PROC -- to be processed | Deposition date: | 2024-08-01 |
|
PDBID: | 9izg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9izh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|