| PDBID: | 8wva | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8qx6 | | Status: | HPUB -- hold until publication | | Title: | Novel laminarin-binding CBM X584 | | Authors: | Zuehlke, M.K., Jeudy, A., Czjzek, M. | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
DFALPINFGADIEYTTGANSVPFEVVTNPEQSGINATDTKVGKVTNQGGQYEALTFLLDEAIDFSGSNKTITMKVYSEVAYQVLFKLETGMNGERANEVEVSHSGNGWEELSFNFNNARNSFVQGDDANNGQPFVPTGQYDEISIFLDFAGFTAGDFYIDDIEQN
|
|
| PDBID: | 8qx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8uph | | Status: | HPUB -- hold until publication | | Title: | Pr state of Stigmatella aurantiaca bacteriophytochrome 2 | | Authors: | Malla, T.N., Schmidt, M., Stojkovic, E.A. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upk | | Status: | HPUB -- hold until publication | | Title: | Pr/Pfr heterodimer (hybrid) state of Stigmatella aurantiaca bacteriophytochrome 2 | | Authors: | Malla, T.N., Schmidt, M., Stojkovic, E.A. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upb | | Status: | HPUB -- hold until publication | | Title: | De novo designed IL-6 mimetic | | Authors: | Borowska, M.T., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv0 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv1 | | Status: | HPUB -- hold until publication | | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | | Authors: | DeMirci, H., Tosun, B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wuz | | Status: | HPUB -- hold until publication | | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8up5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
