| PDBID: | 8rss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 | | Sequence: | >Entity 1
MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
| PDBID: | 8rsw | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pacsin 2 SH3 domain | | Authors: | Tossavainen, H., Permi, P. | | Deposition date: | 2024-01-25 | | Release date: | 2024-02-22 |
|
| PDBID: | 8vsz | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human GABAA receptor pi (GABRP) apo state | | Authors: | Wang, Y., Klein, D. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vt6 | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y24 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y2a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y2b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y28 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Mcl-1 in complex with a long BH3 peptide of BAK | | Authors: | Wang, H., Guo, M., Wei, H., Chen, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the aspartate:alanine antiporter AspT WT | | Authors: | Nanatani, K., Kanno, R., Kawabata, T., Watanabe, S., Hidaka, M., Yamanaka, T., Toda, K., Fujiki, T., Kunii, K., Miyamoto, A., Chiba, F., Ogasawara, S., Murata, T., Humbel, B.M., Inaba, K., Mitsuoka, K., Guan, L., Abe, K., Yamamoto, M., Koshiba, S. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Mcl-1 in complex with a Short BH3 peptide of BAK | | Authors: | Wang, H., Guo, M., Wei, H., Chen, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y21 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium tuberculosis complexed with substrate Palmitoyl-CoA | | Authors: | Ganguly, S.S., Singh, B.K., Saha, R., De, S., Das, A.K. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y20 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Mcl-1 in complex with A-1210477 | | Authors: | Wang, H., Guo, M., Wei, H., Chen, Y. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1t | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF TRYPANOSOMA BRUCEI GAMBIENSE GLYCEROL KINASE COMPLEX WITH ADP and G3P | | Authors: | Balogun, E.O., Inaoka, D.K., Ichinose, M., Chishima, T., Harada, S., Kita, K., Shiba, T. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aquifex aeolicus dUTPase complexed with dUMP. | | Authors: | Fukui, K., Murakawa, T., Yano, T. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of A7 | | Authors: | Dong, C., Yan, X., Zhou, M. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8y1w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Thermococcus pacificus dUTPase complexed with dUMP. | | Authors: | Fukui, K., Murakawa, T., Yano, T. | | Deposition date: | 2024-01-25 |
|
