| PDBID: | 8z2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutamt E324D from Deinococcus radiodurans complexed with validoxylamine A (VAA) | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z1u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9bdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anti-abTCR NANOBODY VHH | | Authors: | Qiu, Y. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bds | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-12 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9bdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdk | | Status: | HPUB -- hold until publication | | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 8z2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253E from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezf | | Status: | HOLD -- hold until a certain date | | Title: | membrane complex from Haemophilus influenzae - conformation C | | Authors: | Castro, D.S.K.V., Delepelaire, P., Biou, V. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 9ezk | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii (apo). | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ezm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z2e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of nanobody Tnb04-1 with antibody 1F11 fab and SARS-CoV-2 RBD | | Authors: | Wang, X.Q., Zhang, L.Q., Chen, J., Dong, H.D. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z27 | | Status: | HPUB -- hold until publication | | Title: | The structure of TGEV RBD and dog APN complex | | Authors: | Sun, J.Q., Niu, S. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z20 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure analysis of thermotolerant Oscillatoria Phycocyanin | | Authors: | Patel, S.N., Sonani, R.R., Gupta, G.D., Upadhyaya, C.T., Sonavane, B.P., Singh, N.K., Kumar, V., Madamwar, D. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z2g | | Status: | HPUB -- hold until publication | | Title: | MHET bound form of PET-degrading cutinase mutant Cut190*SS_S176A | | Authors: | Numoto, N., Kondo, F., Bekker, G.J., Liao, Z., Yamashita, M., Iida, A., Ito, N., Kamiya, N., Oda, M. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z2h | | Status: | HPUB -- hold until publication | | Title: | Substrate analog a010 bound form of PET-degrading cutinase mutant Cut190**SS_S176A | | Authors: | Numoto, N., Kondo, F., Bekker, G.J., Liao, Z., Yamashita, M., Iida, A., Ito, N., Kamiya, N., Oda, M. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-12 |
|
