| PDBID: | 8y85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y82 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y7z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8y80 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the tetrameric SPARSA gRNA-ssDNA complex | | Authors: | Zhang, J.T., Jia, N. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rws | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8rwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a cell adhesion molecule | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a synaptic adhesion receptor | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a synaptic adhesion protein | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7a | | Status: | HPUB -- hold until publication | | Title: | extracellular domains of a synaptic adhesion receptor in complex with a cell adhesion molecule | | Authors: | Liu, H., Meng, J. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8y7h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-04 |
|
