| PDBID: | 9cbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a type III antifreeze protein isoform HPLC12 re-refined using standard protocols | | Authors: | Wlodawer, A., Dauter, Z. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9cbl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution structure of Tx33.1 from Conus textile | | Authors: | Ellgaard, L., Khilji, M.S., Hackney, C.M., Teilum, K. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fry | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fs0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fq9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Caspase recruitment domain (CARD) | | Authors: | Dym, O., Amitai, G., Wein, T., Sorek, R. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fro | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Pent - p-sulfonatocalix[6]arene complex | | Authors: | Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fru | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor and NAD+ | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frm | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of glycogen phosphorylase with an indole derivative | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2024-06-19 | | Sequence: | >Entity 1
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
|
|
| PDBID: | 9frw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Yeast 20S proteasome with human beta1i (1-51) | | Authors: | Maurits, E., Huber, E.M., Decker, P.M., Wang, X., Heinemeyer, W., Florea, B.I., Groll, M., Overkleedt, H.S. | | Deposition date: | 2024-06-19 |
|
