| PDBID: | 9d7u | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7v | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7w | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7x | | Status: | PROC -- to be processed | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Fva1 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.85A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api137 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9gi8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution structure of homodimeric TMEM106B | | Authors: | Schweimer, K., Perez-Borrajero, C., Hennig, J. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9gi6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9gi7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of AAV8 in complex with its receptor | | Authors: | Xu, H., Wang, G.P., Su, X.D. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex I from respirasome closed state 1 bound by metformin and CoQ10 (SC-MetC1-v) | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j6y | | Status: | HOLD -- hold until a certain date | | Title: | lactobacillus salivarius ncRNA hexamer | | Authors: | Wang, L., Xie, J.H., Shang, S.T., Su, Z.M. | | Deposition date: | 2024-08-17 | | Release date: | 2025-08-17 |
|
| PDBID: | 9j70 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Keap1 dimer | | Authors: | Xu, K. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9j71 | | Status: | PROC -- to be processed | | Title: | Keap1_compound_7 | | Authors: | Xu, K., Xu, K. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d6w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Apo Human Prostaglandin reductase 1 (PTGR1) (Monoclinic P form) | | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2024-08-16 | | Sequence: | >Entity 1
MAHHHHHHMGTLEAQTQGPGSMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
|
|
| PDBID: | 9d75 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d78 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apo-OXA-58 | | Authors: | Maggiolo, A.O., Smith, C.A., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7j | | Status: | AUCO -- author corrections pending review | | Title: | Clostridium acetobutylicum alcohol dehydrogenase bound to NADP+ | | Authors: | Madzelan, P., Wilson, M.A. | | Deposition date: | 2024-08-16 |
|
