| PDBID: | 8q6r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2024-08-14 |
|
| PDBID: | 8kex | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-14 | | Release date: | 2025-02-14 |
|
| PDBID: | 8ttq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-14 | | Release date: | 2024-12-31 |
|
| PDBID: | 8ttr | | Status: | HPUB -- hold until publication | | Title: | CA9 mimic bound to SH7 | | Authors: | Peat, T.S. | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8ket | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human complex A | | Authors: | Qian, H.W., He, J.J. | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 8kev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 8kes | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-13 | | Release date: | 2025-02-13 |
|
| PDBID: | 8tt8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8tt9 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
| PDBID: | 8ken | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8kel | | Status: | HPUB -- hold until publication | | Title: | Structure of DexA reveal the novel Mechanism of DNA catalysis | | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | | Deposition date: | 2023-08-12 |
|
| PDBID: | 8q67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 8keb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 8ked | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 8ke0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 8keh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | State 2 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8q6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 8tse | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8tsk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 8tsm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-11 | | Release date: | 2024-08-11 |
|
| PDBID: | 7gau | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition of ground-state model of MAP1LC3B | | Authors: | Kumar, A., Marples, P.G., Tomlinson, C.W.E., Fearon, D., von-Delft, F., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8kdv | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Oval fibril at 3.5 Angstroms resolution | | Authors: | Li, D., Zhang, X., Zhu, P. | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-26 |
|
| PDBID: | 8kdz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-10 |
|
| PDBID: | 8q60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-10 |
|
| PDBID: | 8trw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-10 |
|
