| PDBID: | 8q81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 | | Release date: | 2025-02-17 |
|
| PDBID: | 8q82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 | | Release date: | 2025-02-17 |
|
| PDBID: | 8q83 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 | | Release date: | 2025-02-17 |
|
| PDBID: | 8kg1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the cargo cysteine desulfurase from Mycobacterium smegmatis | | Authors: | Liu, X., Tang, Y., Liu, Y., Ma, M., Gao, Y. | | Deposition date: | 2023-08-17 | | Release date: | 2024-11-17 |
|
| PDBID: | 8q7z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-17 |
|
| PDBID: | 8tuz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 |
|
| PDBID: | 8tv3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 |
|
| PDBID: | 8tv5 | | Status: | HPUB -- hold until publication | | Title: | Structure of the EphA2 LBDCRD bound to FabS1CE_L1 in a 2:1 (EphA2 to Fab) ratio | | Authors: | Singer, A.U., Bruce, H.A., Blazer, L., Adams, J.J., Sicheri, F., Sidhu, S.S. | | Deposition date: | 2023-08-17 |
|
| PDBID: | 8q7d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8q7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8q7g | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8q7o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478) | | Authors: | Hillier, J.S., Zhao, Y., Malinauskas, T., Jones, E.Y. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8q7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 | | Release date: | 2025-02-16 |
|
| PDBID: | 8tuf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human norovirus RNA-dependent RNA-polymerase | | Authors: | Prasad, B.V.V., Kaundal, S., Sankaran, B. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8tue | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8kf9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q6w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LSSmOrange - Directionality of Optical Properties of Fluorescent Proteins | | Authors: | Myskova, J., Brynda, J., Lazar, J. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q78 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8kfl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q6v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2025-06-21 |
|
| PDBID: | 8tu7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8tts | | Status: | HPUB -- hold until publication | | Title: | OXA-48 in complex with CDD-2201 | | Authors: | Park, S., Su, L., Taylor, D., Sun, Z., Ramana, S., Chamakuri, S., Qin, X., Tan, Z., Sharma, K., Li, F., Fan, J., Hu, L., Sankaran, B., Prasad, B.V.V., Matzuk, M., Palzkill, T. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8tu8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8q6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
| PDBID: | 8q6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-14 |
|
