| PDBID: | 8kdn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8kdo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8trf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8q55 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8q5c | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8kcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8kd1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8q4c | | Status: | AUCO -- author corrections pending review | | Title: | Human PEX5 TPR domain in complex with PEX14 KIPSWQIPV peptide | | Authors: | Emmanouilidis, L., Gaussmann, S., Sattler, M. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8kbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8toy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8q2i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2025-02-02 |
|
| PDBID: | 8q2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2025-02-07 |
|
| PDBID: | 8tn4 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, used to study poly-N-acetyl-glucosamine broadly expressed in biofilm-forming pathogenclonal antibody | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
