PDBID: | 8rqy | Status: | AUTH -- processed, waiting for author review and approval | Title: | MakC from the mak operon of Vibrio cholerae | Authors: | Bodra, N., Persson, K. | Deposition date: | 2024-01-21 |
|
PDBID: | 8vrc | Status: | HPUB -- hold until publication | Title: | Tetrahymena thermophila MLP1 RRM domain | Authors: | Donaldson, L.W. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 TFQPIIFSTACEQEGVANWRNITEALLKQHNVHAPYCRFGKLEGNFALNKDKTSQEVIDQLVQDGLQFGESKVTIKVSEGEALSKFWELHGRHYNGVMEL
|
|
PDBID: | 8vrf | Status: | HPUB -- hold until publication | Title: | Sucrose-phosphate synthase-like protein from Leishmania major | Authors: | Gorman, M.A., Parker, M.W., McConville, M.J. | Deposition date: | 2024-01-21 |
|
PDBID: | 8vra | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-01-20 |
|
PDBID: | 8vr8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyv | Status: | HPUB -- hold until publication | Title: | De novo designed protein 0705-5 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyr | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-2 | Authors: | Liu, L.J., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xys | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-1 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyt | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-4 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyu | Status: | HPUB -- hold until publication | Title: | De novo designed protein GPX4-3 | Authors: | Guo, Z., Liu, J.L., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyw | Status: | HPUB -- hold until publication | Title: | De novo designed protein Trx-3 | Authors: | Liu, J.L., Guo, Z., Lai, L.H. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyn | Status: | HPUB -- hold until publication | Title: | Structure of the engineered retro-aldolase RA95.5-8 | Authors: | Kunthic, T., Yu, M.Z., Xiang, Z. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xz3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xym | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CX1 spike protein (6P) | Authors: | Xu, Z.P., Li, L.J., Gu, Y.H., Qi, J.X., Gao, G.F. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyo | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CX1 receptor binding domain in complex with human ACE2 | Authors: | Xu, Z.P., Li, L.J., Gu, Y.H., Qi, J.X., Gao, G.F. | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xyy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xz1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-20 |
|
PDBID: | 8xz0 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz4 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz5 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8xz6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-20 | Release date: | 2025-01-20 |
|
PDBID: | 8rqw | Status: | HPUB -- hold until publication | Title: | Erk2 MAP kinase (T188E) AMP-PNP complex | Authors: | Livnah, O., Gutman, D. | Deposition date: | 2024-01-20 |
|