| PDBID: | 9mno | | Status: | HPUB -- hold until publication | | Title: | Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA | | Authors: | Garrett, S.R., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9mnq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mns | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hum | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9huj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (12 subunits) | | Authors: | Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (20 subunits). | | Authors: | Bereta, G., Bielecka, E., Biela, A., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium | | Authors: | Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hus | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 31, with P-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-23 | | Release date: | 2025-02-17 |
|
| PDBID: | 9hun | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of feruloyl esterase from Fusarium oxysporum G122S variant in complex with benzoic acid | | Authors: | Karampa, P., Dimarogona, M., Topakas, E., Makryniotis, K., Nikolaivits, E. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hux | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Open Tetramer. | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site tRNA | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed1 tetramer. | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9huz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed2 tetramer | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hv0 | | Status: | HPUB -- hold until publication | | Title: | CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Empty monomer. | | Authors: | Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hul | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GSK3b in complex with ARN25423 | | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Tetraspanin CD63mutant Large Extracellular Loop (LEL) in complex with sybody LA4 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hup | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F194 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huo | | Status: | HPUB -- hold until publication | | Title: | A01 mAbs bound to cobratoxin at pH 5.5 | | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hut | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F222 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huu | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F223 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F224 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huw | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F232 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
