PDBID: | 9eu4 | Status: | HPUB -- hold until publication | Title: | GH29A alpha-L-fucosidase | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | Deposition date: | 2024-03-27 | Sequence: | >Entity 1 MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDDEHHHHHH
|
|
PDBID: | 8yuo | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuq | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yur | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yus | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuj | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of Mus musculus IgM pentamer | Authors: | Xin, X., Lin, Y., Jianwei, L., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuy | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mus musculus IgM Fab bound to SARS-CoV2-Spike | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuz | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mus musculus IgM pentamer | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yux | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mus musculus IgM hexamer bound to SARS-Cov2-Spike | Authors: | Xin, X., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yul | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of Mus musculus IgM pentamer | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv0 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | BceAB monomer(resting state) | Authors: | He, Y.T., Li, J.W., Shao, K., Luo, M. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv1 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | BceAB monomer(pre-hydrolysis state) | Authors: | He, Y.T., Li, J.W., Shao, K., Luo, M. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv2 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | BceAB dimer(post-hydrolysis state) | Authors: | He, Y.T., Li, J.W., Shao, K., Luo, M. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yu8 | Status: | HPUB -- hold until publication | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yue | Status: | HPUB -- hold until publication | Title: | Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster | Authors: | Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yub | Status: | HPUB -- hold until publication | Title: | Crystal structure of SARS-CoV-2 ConSp RBD in complex with neutralizing antibody CC25.4 Fab | Authors: | Kang, J.M., Yuan, M., Han, B.W., Wilson, I.A. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yug | Status: | HPUB -- hold until publication | Title: | X-ray Crystal structure of glycoside hydrolase family 18 chitinase from Serratia marcescens hexahistigine-tagged SmChiB apo enzyme | Authors: | Ebi, S., Sunagawa, N., Yamaguchi, S., Igarashi, K. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuc | Status: | HPUB -- hold until publication | Title: | Crystal structure of SARS-CoV-2 ConSp RBD in complex with antibodies PDI222 Fab and COVA1-16 Fab | Authors: | Kang, J.M., Yuan, M., Han, B.W., Wilson, I.A. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuh | Status: | HPUB -- hold until publication | Title: | X-ray Crystal structure of glycoside hydrolase family 18 chitinase from Serratia marcescens hexahistigine-tagged SmChiB with allosamidin | Authors: | Ebi, S., Sunagawa, N., Yamaguchi, S., Igarashi, K. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yun | Status: | HPUB -- hold until publication | Title: | The crystal structure of HNBP001-HCP | Authors: | Chen, C.Z., Xia, Q.F. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yui | Status: | HPUB -- hold until publication | Title: | X-ray Crystal structure of glycoside hydrolase family 18 chitinase from Serratia marcescens hexahistigine-tagged SmChiB with triacetyl chitotriose | Authors: | Ebi, S., Sunagawa, N., Yamaguchi, S., Igarashi, K. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuf | Status: | HPUB -- hold until publication | Title: | Crystal structure of HEPN (Q64A) toxin | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuk | Status: | HPUB -- hold until publication | Title: | Structure of a triple-helix region of human collagen type VII | Authors: | Zhu, Y., Yang, X., Sun, F. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv3 | Status: | HPUB -- hold until publication | Title: | The heterotrimer structure of peptides derived from human collagen type I | Authors: | Zhu, Y., Yang, X., Sun, F. | Deposition date: | 2024-03-27 |
|