| PDBID: | 9oev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oew | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofa | | Status: | HPUB -- hold until publication | | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | | Deposition date: | 2025-04-29 | | Sequence: | >Entity 1
MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
| PDBID: | 9ofk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ABCC6 Apo Structure in GDN | | Authors: | Reddy, B.G. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9off | | Status: | HPUB -- hold until publication | | Title: | human prostamide/prostaglandin F synthase C44SC47S mutant, P212121 crystal form | | Authors: | Nguyen, T.K.Y., Han, B.W. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9oes | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9ofl | | Status: | HPUB -- hold until publication | | Title: | ABCC6 Bound to RTY-14745 Structure in GDN | | Authors: | Reddy, B.G. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r26 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r20 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r24 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r21 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the flotillin-associated rhodopsin PsFAR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Marin, E., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r22 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the light-driven proton pump PsPR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r23 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the double mutant H84V/E120G of the flotillin-associated rhodopsin PsFAR in detergent micelle | | Authors: | Kovalev, K., Stetsenko, A., Guskov, A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r2c | | Status: | HPUB -- hold until publication | | Title: | CpKRS in complex with inhibitor DDD01038762 | | Authors: | Dawson, A., Baragana, B., Robinson, D.A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r28 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r29 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r2a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r25 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-29 |
|
