| PDBID: | 9umj | | Status: | HPUB -- hold until publication | | Title: | Structure of EP54 bound mouse C3aR in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9umm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-22 | | Release date: | 2026-04-22 |
|
| PDBID: | 9umn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-04-22 | | Release date: | 2026-04-22 |
|
| PDBID: | 9umq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TRiC complex with PDCD5 | | Authors: | Li, Z.L., Cong, Y.C. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9ums | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of bacteriophage P1 connector | | Authors: | Yang, F., Liu, H.R. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9umr | | Status: | HPUB -- hold until publication | | Title: | Structure of C5a-pep bound human C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Shukla, A.K. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9umh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9umo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obi | | Status: | HPUB -- hold until publication | | Title: | Room Temperature X-Ray Structure of HIV-1 Protease in Complex with Inhibitor GRL-075-24A | | Authors: | Bhandari, D., Kovalevsky, A., Ghosh, A.K. | | Deposition date: | 2025-04-22 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9obe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obh | | Status: | HPUB -- hold until publication | | Title: | Co-Structure of SARS-CoV-2 with Compound 34 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with 5-[(E)-3-(p-methoxyphenyl)-2-propenylidene]-2,4,6(1H,3H,5H)-pyrimidinetrione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obm | | Status: | HPUB -- hold until publication | | Title: | Solution structure or pre-miR-20a | | Authors: | Keane, S.C. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obk | | Status: | HPUB -- hold until publication | | Title: | A-beta42-Met-R-SO amyloidal fibril | | Authors: | Chan, K.L., Boyer, D., Balasco Serrao, V.H., Raskatov, J.A. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obj | | Status: | AUCO -- author corrections pending review | | Title: | Room temperature structure of carbonic anhydrase II in complex with vorinostat (drug soak) | | Authors: | Gulkis, M.C., McKenna, R., Fisher, S.Z. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 mutant peptide GLAPPQHLFRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human broadly neutralizing antibody K579 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 peptide GLAPPQHLIRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9qzc | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9qzf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9qz4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9qz5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-22 |
|
