| PDBID: | 9qpm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpd | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpf | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Sox2 DBD | | Authors: | Orsetti, A., van Ingen, H. | | Deposition date: | 2025-03-27 | | Sequence: | >Entity 1
GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
| PDBID: | 9qpl | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpg | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9u8f | | Status: | HPUB -- hold until publication | | Title: | The Cryo-EM Structure of Full-Length Extracellular Domain of NKp46 in Complex with OmniClic Fab and Two OmnidAb nanobodies. | | Authors: | Srivastava, D.B., Zeng, B., Rivera, G., Harriman, W. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u85 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u89 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of AA(GGGTT)3GGGAA G-quadruplex in the presence of potassium ions | | Authors: | Negi, D., Sannapureddi, R.K.R., Sathyamoorthy, B. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u86 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u87 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u88 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8i | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of human ATP9A | | Authors: | Zhu, K.F., Zhang, H.W. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8m | | Status: | HPUB -- hold until publication | | Title: | Drosophila melanogaster Nicotinamidase in Complex with Inhibitor CN2 | | Authors: | Li, G.-B., Chen, Y.-T. | | Deposition date: | 2025-03-26 |
|
