| PDBID: | 9mld | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella | | Authors: | Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlj | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease covalently bound to compound GRL-050-23 at 1.6 A | | Authors: | Beechboard, S.B., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVT(CSO)GTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD(CSO)VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9mlm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mly | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlr | | Status: | HPUB -- hold until publication | | Title: | Halfwrap gamma-H2Ax containing nucleosome | | Authors: | Panigrahi, R., Edwards, R., Glover, J.N.M. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mls | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm4 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH9.5-pH8; 7s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 9.5 and soaked in pH 8 for 7s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9htd | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type II collagen prolyl 4-hydroxylase complexed with Pro-Hyp-Gly-Pro-Ala-Gly-Pro-Hyp-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hte | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hta | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Terribacillus saccharophilus Dispts2 in complex with NAG-thiazoline | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Franco Cairo, J.P.L., Pache, R.A., Vejborg, R.M., Bhosale, S., Vocadlo, D., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht9 | | Status: | HPUB -- hold until publication | | Title: | CutC in complex with inhibitor1 | | Authors: | Petersen, J. | | Deposition date: | 2024-12-19 |
|
