| PDBID: | 8yxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yya | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Concanavalin A Complexed with 5-Fluorouracil | | Authors: | Rasheed, S., Arif, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy0 | | Status: | HPUB -- hold until publication | | Title: | Vo domain of V/A-ATPase from Thermus thermophilus state2 | | Authors: | Kishikawa, J., Nishida, Y., Nakano, A., Yokoyama, K. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yye | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8yyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 9b9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba4 | | Status: | HOLD -- hold until a certain date | | Title: | full-length cross-linked Contactin 2 (CNTN2) | | Authors: | Liu, J.L., Fan, S.F., Ren, G.R., Rudenko, G.R. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
