| PDBID: | 9ljc | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 2). | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lja | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 1)- polymorph 1. | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9ljb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of amyloid fibrils from abdominal fat of a multiple myeloma patient (case 1)- polymorph 2. | | Authors: | Yao, Y.X., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lic | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo form of protein tyrosine phosphatase 1B (PTP1B) | | Authors: | Do, H., Hwang, J., Lee, J.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lif | | Status: | HPUB -- hold until publication | | Title: | Repetitive domain (RP) 1 structure of aciniform spidroin from Latrodectus hesperus | | Authors: | Yang, R., Qin, R., Yuan, W., Lin, Z. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lim | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lil | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lih | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Mitochondrial Respiratory Complex II in cyclobutrifluram-bound state | | Authors: | Li, Z.W., Ye, Y., Yang, G.F. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lig | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Mitochondrial Respiratory Complex II in Y19315-bound state | | Authors: | Li, Z.W., Ye, Y., Yang, G.F. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lia | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AaHPPD-ZD001 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lij | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of oxidized form (C92-C121) of protein tyrosine phosphatase 1B (PTP1B) | | Authors: | Do, H., Hwang, J., Lee, J.H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lik | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lin | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo dGCA1_L83A | | Authors: | Bao, Y., Li, Y., Zhang, X., Xie, Z., Song, P., HUang, j., Wan, Z., Ji, P. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lie | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lio | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lj3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of P25 | | Authors: | Yang, P., Chen, M.R., Xiao, Y.B. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lip | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of the native PMEL fibril lamella | | Authors: | Ma, B.Y., Yao, Y.X., Dong, H., Li, D., Liu, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9liu | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-14 | | Release date: | 2026-01-14 |
|
| PDBID: | 9lj2 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-01-14 | | Release date: | 2026-01-14 |
|
| PDBID: | 9lj4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structures Uncover the Unexpected Hinges of IscB for Enhanced Gene Editing | | Authors: | Hu, C.Y., Wang, F.Z., Ma, S.S., Zhang, S.F. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lj7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i05 | | Status: | PROC -- to be processed | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i07 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glycerldeyde-3-phosphate dehydrogenase hexadecamer (major conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i06 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glyceraldehyde-3-phosphate dehydrogenase (minor conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
