| PDBID: | 9yj0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.16 Fab in complex with P94_v18_c046 Chimera DS-SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yji | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yj1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.31 Fab in complex with BG505 SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjl | | Status: | HPUB -- hold until publication | | Title: | Joint X-ray/neutron structure of wild-type Bacillus halodurans RNase H1 in the apo-form | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-03 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
|
|
| PDBID: | 9yjm | | Status: | HPUB -- hold until publication | | Title: | Joint X-ray/neutron structure of D132N Bacillus halodurans RNase H1 in the apo-form | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-03 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
|
|
| PDBID: | 9yjr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K601 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K400 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CRBN bound to 1-[1-(4-piperidyl)indol-4-yl]hexahydropyrimidine-2,4-dione in the open conformation | | Authors: | Cowan, A.D., Rutter, Z.J., McAulay, K., Ciulli, A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ORF904 tetramer bound to dsDNA | | Authors: | Clery, A., Rabl, J., Schneider, A., Wu, P., Lipps, G., Allain, F.H.T. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-03 |
|
