| PDBID: | 9t00 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9szx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C9 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t06 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of OXA-244 beta-lactamase K73A mutant | | Authors: | Nermont, R., Oueslati, S., Naas, T., Iorga, B.I., Retailleau, P. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0c | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Atg2-Atg18 complex from yeast | | Authors: | Chumpen Ramirez, S., Shvarev, D., Vargas Duarte, P., Milach, J., Lang, E., Kuchenbuch, S., Reggiori, F., Moeller, A., Ungermann, C. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t08 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of wild-type c-MET bound by sitravatinib. | | Authors: | Collie, G.W. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of D1228V c-MET bound by sitravatinib. | | Authors: | Collie, G.W. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of wild-type c-MET bound by glesatinib | | Authors: | Collie, G.W. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of L-Threonate 3-dehydrogenase from Paracoccus litorisediminis (ligand-free form) | | Authors: | Watanabe, S., Sato, H. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x68 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-10-15 | | Release date: | 2026-10-15 |
|
| PDBID: | 9x6g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella oxytoca ribitol dehydrogenase in complex with D-allulose | | Authors: | Yoshida, H., Yoshihara, A. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella oxytoca ribitol dehydrogenase in complex with NAD+ | | Authors: | Yoshida, H., Yoshihara, A. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6a | | Status: | HOLD -- hold until a certain date | | Title: | carboxylesterase EstC | | Authors: | Chen, Q., Li, B. | | Deposition date: | 2025-10-15 | | Release date: | 2026-04-15 |
|
| PDBID: | 9x6b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Songling virus nucleoprotein | | Authors: | Yanshin, A.O., Gladysheva, A.V. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x67 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the type I pilus from Escherichia Coli and the surrounding water network | | Authors: | Petrova, T.E., Glukhov, A.S., Stetsenko, A., Guskov, A., Gabdulkhakov, A.G. | | Deposition date: | 2025-10-15 | | Sequence: | >Entity 1
AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
|
|
| PDBID: | 9x6t | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-10-15 | | Release date: | 2026-10-15 |
|
| PDBID: | 9x6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Psl polysaccharide related protein structures | | Authors: | Jiao, L., Yihua, H. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x69 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-10-15 |
|
