| PDBID: | 9x72 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x73 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x79 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Paenibacillus kribbensis D-ribose-5-phosphate isomerase B | | Authors: | Kamitori, S. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRIAIGSDHVAIELKAIISAYVNELGHEVMDYGPKTSERTDYPKYGKLVAEAVVGKQADAGILICGTGVGISISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVGSELAKMIVKAWLEAEFEGGRHGDRIKMISDIEEQHLC
|
|
| PDBID: | 9x75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x77 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Paenibacillus kribbensis D-allose kinase | | Authors: | Kamitori, S. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMDSNERIQGGYTIGIDIGGTNFRIGLLSEMGELRHFHIESSRLLYAEGEPQDNLRNYITSYIQKHPEAEIKGIGIGFPSVVSKDKKTVYSTPNIEGFNQVNVVDPLESALAIPVYLDNDVNFLLLTEIVAHKLERRGIVVGFYLGTGFGNSIYYEDHFIAGKHGSAAELGHVPVLGRQDLCSCGNPGCIEQYASGKRLRELHELHFAGTPFEDIFVKYGSHEIIQDFLEAVAVVIATEINILDPDYIVLGGGVLHMSGFPKKELEAKIYSHARKPFPAEGLNYIYAKDNQEAGVIGAGYRAWRGNSPALIK
|
|
| PDBID: | 9x78 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x7a | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Paenibacillus kribbensis D-allulose-6-phosphate 3-epimerase | | Authors: | Kamitori, S. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMKKHLFSPSLMCMNLMDIENQLKVLNQRADMVHIDIMDGHYVKNITLSPYFMEQIRESLTIPMDVHLMVEKPSEFIKMIIDAGATYISPHAEVINSEAFRMIDTIKSAGCKAGIALNPATPLSHIQHYIHHLDKITFMSVDPGFAGQKFIPEVLDKIREARALKEKHGYNYLIEIDGSCNEKTFKILEEAGVEVFIVGTSGLFNLDSDLNKAWDQMMEHFNSQVNAEV
|
|
| PDBID: | 9yrh | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of human beta-cardiac myosin bound to omecamtiv mecarbil in the interacting-heads motif and S2-FH undocked state | | Authors: | Somavarapu, A.K., Craig, R., Padron, R. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr9 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yre | | Status: | HPUB -- hold until publication | | Title: | RNA oligonucleotides containing 4''-(R)-methyl-alpha-(L)-threofuranosyl nucleic acid. | | Authors: | Harp, J.M., Egli, M. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yqs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-16 |
|
