| PDBID: | 9hs9 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (unclear crosslink from Lys), damage-free | | Authors: | Pfalzgraf, H.E., Adams, H.R., Sugimoto, H., Tosha, T., Horrell, S., Jaho, S., Beilsten-Edmands, J., Tews, I., Worrall, J.A.R., Owen, R.L., Hough, M.A. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsa | | Status: | HOLD -- hold until a certain date | | Title: | Solution structure of X55, a computationally designed protein | | Authors: | Schweimer, K., Hennig, J., Perez-Borrajero, C. | | Deposition date: | 2024-12-19 | | Release date: | 2025-01-16 | | Sequence: | >Entity 1
SMDKEWISKLPKSPEPWTPEQEEAFLKRFAEKVDPEETLKKLEEWIKENIKKYPEYKDELEVAYNSAKLFLESPLVEGPGKVRAIGRVLWTIKRLNIDSPFV
|
|
| PDBID: | 9ht8 | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type I collagen prolyl 4-hydroxylase complexed with Pro-Pro-Gly-Pro-Ala-Gly-Pro-Pro-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htc | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 1600 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htb | | Status: | HPUB -- hold until publication | | Title: | CutC in complex with inhibitor2 | | Authors: | Petersen, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.19 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htv | | Status: | PROC -- to be processed | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.95 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked complex of ketosynthase FabB mutant FabBG107M and acyl carrier protein AcpP from E.coli with C12 crosslinker | | Authors: | Jiang, Z., Sankaran, B., Burkart, M.D., Fox, J.M. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm3 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH9.5-pH8; 4s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 9.5 and soaked in pH 8 for 4s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mle | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta | | Authors: | Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mll | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella | | Authors: | Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mly | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
