| PDBID: | 9nnl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn4 | | Status: | HPUB -- hold until publication | | Title: | BET BRD3-BD1 in complex with peptide 7.2 | | Authors: | Jing, X., Mackay, J.P. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn5 | | Status: | HPUB -- hold until publication | | Title: | BET BRD4-BD1 in complex with peptide 9.2 | | Authors: | Jing, X., Mackay, J.P. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Serendipita indica sulfate transporter SiSulT in oxlate bound state | | Authors: | Khandelwal, N.K., Kumar, P., Gupta, M., Finer-Moore, J., Stroud, R.M. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nng | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFIDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9nnn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of amyloid fibril extracted from the heart of a variant ATTR D38A amyloidosis patient | | Authors: | Nguyen, B., Afrin, S., Saelices, L. | | Deposition date: | 2025-03-05 | | Release date: | 2026-03-05 |
|
| PDBID: | 9nne | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nni | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nnf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of a de-novo designed binder NY1-B04 in complex with HLA-A*02:01 and NY-ESO-1-derived peptide SLLMWITQC | | Authors: | Gharpure, A., Fernandez-Quintero, M.L., Ward, A.B. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nn9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Rhizobium etli L-asparaginase ReAV S48A mutant | | Authors: | Pokrywka, K., Grzechowiak, M., Loch, J.I., Ruszkowski, M., Gilski, M., Jaskolski, M. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Rhizobium etli L-asparaginase ReAV K51A mutant | | Authors: | Pokrywka, K., Grzechowiak, M., Loch, J.I., Ruszkowski, M., Gilski, M., Jaskolski, M. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Rhizobium etli L-asparaginase ReAV S80A mutant | | Authors: | Pokrywka, K., Grzechowiak, M., Loch, J.I., Ruszkowski, M., Gilski, M., Jaskolski, M. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA-PK bound to 153 bp H2AX nucleosome model 2 | | Authors: | Hall, C., Chaplin, A. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qcx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9qd1 | | Status: | HPUB -- hold until publication | | Title: | Structure of J paramyxovirus virus receptor binding protein | | Authors: | Stelfox, A.J., Bowden, T.A. | | Deposition date: | 2025-03-05 |
|
