| PDBID: | 9n9l | | Status: | HPUB -- hold until publication | | Title: | An RORgt Inverse agonist for treatment of Psoriasis | | Authors: | Spurlino, J.C., Milligan, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nab | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab | | Authors: | Wang, L., Zhang, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of truncated USP1:UAF1 in complex with compound 18 | | Authors: | Whittington, D.A. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n9x | | Status: | HPUB -- hold until publication | | Title: | Structure of HPK1 with C5 bound at its active site | | Authors: | Kiefer, J.R., Wang, W., Wu, P., Walters, B.T., Dou, Y. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9naa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Unusual structure of a bacteriophytochrome fragment derived from full length SaBphP2 | | Authors: | Schmidt, M., Prabin, K. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nac | | Status: | HPUB -- hold until publication | | Title: | Structure of HPK1 with C4 bound at its active site | | Authors: | Kiefer, J.R., Wang, W., Wu, P., Walters, B.T., Dou, Y. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lut | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PSI-LHCI supercomplex binding with 4 Lhcas from M. polymorpha | | Authors: | Tsai, P.-C., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luu | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | PSI-4 LHCI dimer supercomplex from M. polymorpha | | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luw | | Status: | HPUB -- hold until publication | | Title: | Enhancing Monodispersity and Thermal Stability of Human H-Ferritin for Improved Applications in Nanocarrier Systems | | Authors: | Gu, C.K., Wang, S.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lux | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9lus | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9iaf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-10 |
|
