| PDBID: | 9ngk | | Status: | HPUB -- hold until publication | | Title: | Nanotube of Y5 - (4 protofilament) | | Authors: | Das, A., Conticello, V.P. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngo | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable mH2A* SUBSTRATE PRE-MRNA (FOCUS MAP) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngv | | Status: | HPUB -- hold until publication | | Title: | In-situ cryo-EM structure of periplasmic ring (PR) of the Dot/Icm machine | | Authors: | Yue, J., Jun, L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9q85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9q86 | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 9.5 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9lzh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz3 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 100-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz4 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 200-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz5 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 300-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz6 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured by mix-and-inject serial crystallography at 400-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz7 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 | | Sequence: | >Entity 1
ASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNGTVISAVELDTAATGELPVLEEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDVVSKEVTRVIDTGVFPVPAEHGNYTDPELTGPLRTTQKPISITQPEGPSFTVTGGNHIEWEKWSLDVGFDVREGVVLHNIAFRDGDRLRPIINRASIAEMVVPYGDPSPIRSWQNYFDTGEYLVGQYANSLELGCDCLGDITYLSPVISDAFGNPREIRNGICMHEEDWGILAKHSDLWSGINYTRRNRRMVISFFTTIGN(2TY)DYGFYWYLYLDGTIEFEAKATGVVFTSAFPEGGSDNISQLAPGLGAPFHQHIFSARLDMAIDGFTNRVEEEDVVRQTMGPGNERGNAFSRKRTVLTRESEAVREADARTGRTWIISNPESKNRLNEPVGYKLHAHNQPTLLADPGSSIARRAAFATKDLWVTRYADDERYPTGDFVNQHSGGAGLPSYIAQDRDIDGQDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRPEGFFDRSPVLDVPAN
|
|
| PDBID: | 9lz8 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz9 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lza | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzb | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzc | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
