| PDBID: | 9ev1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 8yvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yv9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yva | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 8yvb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
| PDBID: | 9b7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the H3 hemagglutinin COBRA TJ2 | | Authors: | Dzimianski, J.V., DuBois, R.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab2-1 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab2-2 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab2-3 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab2-4 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7d | | Status: | HPUB -- hold until publication | | Title: | Structure of ThsB-Tad3 complex | | Authors: | Hobbs, S.J., Tan, J.M.J., Yirmiya, E., Sorek, R., Kranzusch, P.J. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab2-5 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab2-6 in complex with the capsid of Adeno-associated virus type 9 | | Authors: | Mietzsch, M., McKenna, R. | | Deposition date: | 2024-03-27 |
|
