| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 9b9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba8 | | Status: | HPUB -- hold until publication | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J., Romero, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bab | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9bac | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~24 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9ba9 | | Status: | HPUB -- hold until publication | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew1 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, CRAF phosphopeptide (pS259) and compound 79 (1124379). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12-mer (pS259) and compound 78 (1084378) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12mer (pS259) and compound 86 (1124384) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew5 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) 12mer and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew7 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and CRAF phosphopeptide (pS259) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew6 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and BRAF phosphopeptide (pS365) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ewb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
GAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVKGETKYLGVCRLPGPGRRHRRLDIRVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGAKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
>Entity 2
(DC)(DG)(DG)(DC)(DA)(DG)(DT)(DA)(DC)(DT)(DG)
>Entity 3
(DC)(DA)(DG)(DT)(DA)(DC)
>Entity 4
(DG)(DC)(DC)(DG)
|
|
