| PDBID: | 9lip | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of the native PMEL fibril lamella | | Authors: | Ma, B.Y., Yao, Y.X., Dong, H., Li, D., Liu, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lj4 | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structures Uncover the Unexpected Hinges of IscB for Enhanced Gene Editing | | Authors: | Hu, C.Y., Wang, F.Z., Ma, S.S., Zhang, S.F. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9lj7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i05 | | Status: | PROC -- to be processed | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i06 | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A8B8 glyceraldehyde-3-phosphate dehydrogenase (minor conformer) from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F. | | Deposition date: | 2025-01-14 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzm | | Status: | HPUB -- hold until publication | | Title: | 235 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzn | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzo | | Status: | HPUB -- hold until publication | | Title: | 270 A C1 SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzp | | Status: | HPUB -- hold until publication | | Title: | 270 A C2 SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzq | | Status: | HPUB -- hold until publication | | Title: | 280 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzr | | Status: | HPUB -- hold until publication | | Title: | 290 A SynPspA H1-5 rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i04 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ku70/80, DNA bound to Polymerase Mu | | Authors: | Chaplin, A.K., Amin, H. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzs | | Status: | HPUB -- hold until publication | | Title: | 200 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzt | | Status: | HPUB -- hold until publication | | Title: | 215 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzu | | Status: | HPUB -- hold until publication | | Title: | 235 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzv | | Status: | HPUB -- hold until publication | | Title: | 250 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzw | | Status: | HPUB -- hold until publication | | Title: | 270 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzx | | Status: | HPUB -- hold until publication | | Title: | 280 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzy | | Status: | HPUB -- hold until publication | | Title: | 290 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzz | | Status: | HPUB -- hold until publication | | Title: | 305 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i00 | | Status: | HPUB -- hold until publication | | Title: | 320 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9i01 | | Status: | HPUB -- hold until publication | | Title: | 345 A SynPspA rod after incubation with EPL | | Authors: | Hudina, E., Junglas, B., Huesgen, P., Sachse, C. | | Deposition date: | 2025-01-14 |
|
| PDBID: | 9hzl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-14 |
|
