| PDBID: | 9h4f | | Status: | HPUB -- hold until publication | | Title: | Structure of Imine Reductase 361 from Micromonospora sp. mutant M125W/I127F/L179V/H250L | | Authors: | Ho, E., Domenech, J., Crossley, A., Green, A.P., Grogan, G. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9h4b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 Mpro in complex with GK-730 | | Authors: | El Kilani, H., Hilgenfeld, R. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9h4e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | trans-aconitate decarboxylase Tad1- wild type binding with glycerol | | Authors: | Zheng, L., Bang, G. | | Deposition date: | 2024-10-18 | | Release date: | 2025-10-18 |
|
| PDBID: | 9h4g | | Status: | HOLD -- hold until a certain date | | Title: | trans-aconitate decarboxylase Tad1-R360A binding with trans-aconitate | | Authors: | Zheng, L., Bang, G. | | Deposition date: | 2024-10-18 | | Release date: | 2025-10-18 |
|
| PDBID: | 9h4h | | Status: | HOLD -- hold until a certain date | | Title: | trans-aconitate decarboxylase Tad1_S320A | | Authors: | Zheng, L., Bange, G. | | Deposition date: | 2024-10-18 | | Release date: | 2025-10-18 |
|
| PDBID: | 9h4d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a single nucleosome (1) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0s | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a the periplasmic insert from Myxococcus TAtC | | Authors: | Deme, J.C., Bryant, O.J., Berks, B.C., Lea, S.M. | | Deposition date: | 2024-10-18 | | Sequence: | >Entity 1
(MSE)GS(MSE)FTFLLNEEETLALEQRLDTARLRADDALRFLRLGEAEEAGRIAKETSTQLRAEGQGQAPAPEVAPAASVE(MSE)TGRLDGLGRLLDAASVGYGAQSRGVLRQAVEKRVEAVTAYEKKDFAAAAAA(MSE)DGSASLLAGIAPTRTEELAGLWRLEKELATAHAAHEAARWTRP(MSE)LS(MSE)HEQLSENLYFQ
|
|
| PDBID: | 9e0i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the HKU5-19s RBD bound to the Bos taurus ACE2 receptor | | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k2r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ligand-free human melanocortin receptor 3 (MC3R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ligand-free human melanocortin receptor 5 (MC5R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-18 |
|
