PDBID: | 9dwg | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwn | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwa | Status: | HPUB -- hold until publication | Title: | Crystal structure of FABLE, MPD condition | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwb | Status: | HPUB -- hold until publication | Title: | Crystal structure of FABLE, PEG 400 condition | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwc | Status: | HPUB -- hold until publication | Title: | Crystal structure of FABLE, PEG 600 condition | Authors: | Correy, G.J., Fraser, J.S. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwo | Status: | HPUB -- hold until publication | Title: | Crystal Structure of C4-Dicarboxylate-Binding Protein (PA0884) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | Deposition date: | 2024-10-09 | Sequence: | >Entity 1 SNAAQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
PDBID: | 9dwq | Status: | AUTH -- processed, waiting for author review and approval | Title: | PKD2 ion channel, F629S variant | Authors: | Esarte Palomero, O., DeCaen, P.G. | Deposition date: | 2024-10-09 |
|
PDBID: | 9dwp | Status: | HPUB -- hold until publication | Title: | Crystal Structure of C4-Dicarboxylate-Binding Protein (PA0884) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with Mesaconic Acid | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | Deposition date: | 2024-10-09 | Sequence: | >Entity 1 SNAAQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
PDBID: | 9jve | Status: | HPUB -- hold until publication | Title: | Crysral structure of 2-keto-3-deoxypentonate 4-dehydrogenase from Herbaspirillum huttiense (apo form) | Authors: | Watanabe, S., Akagashi, M. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvf | Status: | HPUB -- hold until publication | Title: | Structure of P450BytO in complex with pentapeptide MRYYH | Authors: | Wang, H.Q., Xiang, Z. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvj | Status: | HPUB -- hold until publication | Title: | Structure of P450BytO mutant V219H in complex with pentapeptide MRYYH | Authors: | Wang, H.Q., Xu, C., Ye, T., Xiang, Z. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvh | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the mmGPR4-Gs receptor in pH6.2 | Authors: | Wen, X., Rong, N.K., Yang, F., Sun, J.P. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvt | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvz | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of M. tuberculosis ClpP1P2 bound to bortezomib | Authors: | Zhou, B., Zhao, H., Gao, Y., Chen, W., Zhang, T., He, J., Xiong, X. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvq | Status: | AUTH -- processed, waiting for author review and approval | Title: | A protein complex | Authors: | Takeda, H., Endo, T., Kikkawa, M., Akihisa, T. | Deposition date: | 2024-10-09 | Release date: | 2025-10-09 |
|
PDBID: | 9jvk | Status: | HPUB -- hold until publication | Title: | Crystal structure of PHBDD-M1-L163G with product N-ethyl-4-methylbenzamide | Authors: | Yang, J. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvs | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of PHBDD-M1 with 4-formyl-N-methylbenzamide | Authors: | Yang, J. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvl | Status: | AUTH -- processed, waiting for author review and approval | Title: | Co-crystal structure of PHBDD-M1-L163G-T234A with N-cyclopropyl-4-methylbenzamide | Authors: | Yang, J., Gao, L., Qiu, X. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jw2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of PHBDD | Authors: | Yang, J. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvy | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of PHBDD-M1 with 1H-pyrrolo[2,3-b]pyridine-4-carbaldehyde | Authors: | Yang, J., Qiu, X. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvi | Status: | HPUB -- hold until publication | Title: | Crystal structure of OsSPS3 complexed with YH24288 | Authors: | Xiao, H., Li, M., Yang, G.-F. | Deposition date: | 2024-10-09 |
|