| PDBID: | 8v6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6b | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 8v65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v66 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v69 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v5v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v60 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v63 | | Status: | HOLD -- hold until a certain date | | Title: | R207A mutant of human Slo1 in presence of EDTA - activated VSD | | Authors: | Pal, K., Kallure, G.S., Chowdhury, S. | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v64 | | Status: | HOLD -- hold until a certain date | | Title: | RCK1-RCK2 double mutant of human Slo1 in presence of EDTA - resting VSD | | Authors: | Pal, K., Kallure, G.S., Chowdhury, S. | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8x9l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9m | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9i | | Status: | HPUB -- hold until publication | | Title: | Solution structure of free PDL1 promoter G-quadruplex | | Authors: | Liu, Y.S., Wang, K.B. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9p | | Status: | HPUB -- hold until publication | | Title: | HURP (428-534)-alpha-tubulin-beta-tubulin complex | | Authors: | Chen, P.-P., Hsia, K.-C. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9o | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9k | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8r8v | | Status: | HPUB -- hold until publication | | Title: | Human PADI4 in complex with cyclic peptide PADI4_11 | | Authors: | Benton, D.J., Bertran, M.T., Walport, L.J. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8r96 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8r8u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8r9v | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the primed actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-11-30 |
|
