| PDBID: | 9iqv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of MT3-alpha1AAR | | Authors: | Zhong, Y.X., Tao, H.H., Tao, Y.Y. | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9iqw | | Status: | HOLD -- hold until a certain date | | Title: | phage HY126 bisphosphate phosphatase | | Authors: | Yu, H. | | Deposition date: | 2024-07-13 | | Release date: | 2025-07-13 |
|
| PDBID: | 9ir3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Nipah virus L-P polymerase complex | | Authors: | Shi, Y., Peng, Q. | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9ir1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CTB10-M40BpA | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9iqz | | Status: | HOLD -- hold until a certain date | | Title: | phage HY126 glycosyltransferase | | Authors: | Yu, H. | | Deposition date: | 2024-07-13 | | Release date: | 2025-07-13 |
|
| PDBID: | 9ir0 | | Status: | HOLD -- hold until a certain date | | Title: | phage HY126 glycosyltransferase with UDP | | Authors: | Yu, H. | | Deposition date: | 2024-07-13 | | Release date: | 2025-07-13 |
|
| PDBID: | 9ir2 | | Status: | HOLD -- hold until a certain date | | Title: | phage HY126 hydroxylase | | Authors: | Yu, H. | | Deposition date: | 2024-07-13 | | Release date: | 2025-07-13 |
|
| PDBID: | 9iqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cma | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cm9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model derived from localized reconstruction of Ad657-hexon-FX complex at 3.86A resolution | | Authors: | Reddy, V.S., Ma, O.X. | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9cmb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-13 |
|
| PDBID: | 9g3v | | Status: | HPUB -- hold until publication | | Title: | Structure of the human nuclear cap-binding-complex (CBC) | | Authors: | Martin, K., Hoh, F., Trapani, S., Tazi, J., Bron, P. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3h | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase twisted tube with no gap between between double strands | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3i | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase twisted tube with 18 Angstrom gap between double strands | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3j | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase twisted tube with 28 Angstrom gap between double strands | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3k | | Status: | HPUB -- hold until publication | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 | | Sequence: | >Entity 1
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
| PDBID: | 9g3l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3w | | Status: | HPUB -- hold until publication | | Title: | Human Gamma-D crystallin R36S mutant with TNB-Cystein Protein modification | | Authors: | Hill, J.A., Pulnova, Y., Yorke, B.A. | | Deposition date: | 2024-07-12 |
|
