| PDBID: | 9b4b | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4c | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:A nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b45 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Pseudomonas phage Pa193 baseplate complex and tail fiber | | Authors: | Iglesias, S.M., Cingolani, G. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b47 | | Status: | HPUB -- hold until publication | | Title: | Y328F variant of P. indica phosphate transporter | | Authors: | Gupta, M., Finer-Moore, J., Stroud, R.M. | | Deposition date: | 2024-03-20 | | Sequence: | >Entity 1
GPMLADLDHFGKNYKHDEEAQRNQKPWMLTWPQIKLVLLAGVGFFLDAYDLFIINQVAPMLAQVYFPKTGLPAQRQDLMKAAANIGCVVGQVMFGVLGDSFGRKFVYGKELILIIVATIFQMSAPSHWDGNRVLTWITICRVFLGIGIGGDYPMSATVVSDRANIHRRGTLLCFIFANQGWGSFVGSLVTIVTISGFKHRLKSGHTHDVDKAWRILIGLSLIPAFGTLYQRLTLPESRKFELTRDAASSSTVAIDKKDHDATHEVKDAPESEKSSPKVTPADAIDDDRHGVIASKKAHWQEFVAYFSTWNHFRNLLGSMLGWFLVDIAFFGINLNQSVVLAQIGFAGKTGDVYDKLFQLATGNIIVTALGFLPGYYFTLFLIDIVGRKKLQFMGFIMSGLFLAILAGEIDHIGKGPLLACFTFMQFFFNFGANTTTFIVAAELFPTRIRASAHGISAAAGKCGAILSSLVFNQLKAKIGTSAVLWIFFSTCILGFISTFLIDETMGVDPDEKDLEERRARGEIPGGLVPR
|
|
| PDBID: | 9b43 | | Status: | HPUB -- hold until publication | | Title: | Mycolicibacterium smegmatis MmpL4 structure | | Authors: | Maharjan, R., Klenotic, P.A., Zhang, Z., Yu, E.W. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b46 | | Status: | HPUB -- hold until publication | | Title: | Mycolicibacterium smegmatis MmpL5 structure | | Authors: | Maharjan, R., Klenotic, P.A., Zhang, Z., Yu, E.W. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9epn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq8 | | Status: | HPUB -- hold until publication | | Title: | Quadruple mutant (N51I+C59R+S108N+I164L) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS V1/S) complexed with FB8, NADPH and dUMP | | Authors: | Vanichtanankul, J., Vitsupakorn, D., Saeyang, T., Arwon, U., Hoarau, M., Decharuangsilp, S., Kamchonwongpaisan, S., Yuthavong, Y. | | Deposition date: | 2024-03-19 | | Sequence: | >Entity 1
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
|
|
