| PDBID: | 9htm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hti | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with succinate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PA0884, the SBP component of a Pseudomonas aeruginosa PAO1 Tripartite ATP-independent Periplasmic (TRAP) transporter, complexed with itaconate | | Authors: | Herman, R., Mehboob, J., Elston, R., Afolabi, H., Kinniment-Williams, B.E., Wilkinson, A.J., Thomas, G.H. | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
AQPIVIKFSHVVAENTPKGQGALLFKKLVEQRLGGRVEVDVYPNSSLFGDGKEMEALLLGDVQMLAPSLAKFEQYTRKVQIFDLPFLFDDIQAVDRFQRSPQGRALLTSMQGKGILGLAYWHNGMKQLSANRPLLEPEDARGLKFRVQASDVLNEQFRQLRAISRKMSFAEVYQGLQTGVVNGTENTWSNYESQKVNEVQKYFTESNHGLVDYMVITNAKFWNGLPADIREELQRIMDEVTVQVNLEAERLNRDARQRILASGASEIHTLSPQQRADWRQAMQPVWQKFRGNVGADLLQAAEASNRPD
|
|
| PDBID: | 9ht0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htd | | Status: | HPUB -- hold until publication | | Title: | Peptide-substrate-binding (PSB) domain of human type II collagen prolyl 4-hydroxylase complexed with Pro-Hyp-Gly-Pro-Ala-Gly-Pro-Hyp-Gly. | | Authors: | Sulu, R., Rahman, M.M., Wierenga, R.K., Koski, M.K. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hte | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with (5-methyl-3-isoxazolyl)methylamine | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with tyramine | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hse | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with 5-(aminomethyl)pyridin-2-amine | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with 2-carbamimidoylacetamide | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with CDP-Choline | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with Cytidine-triphosphate | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Tetraspanin CD82 Large Extracellular Loop (LEL) | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with Phosphocholine | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hsj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with piperidin-3-ol | | Authors: | Audebert, S., Gelin, M., Guichou, J.-F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hta | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Terribacillus saccharophilus Dispts2 in complex with NAG-thiazoline | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Franco Cairo, J.P.L., Pache, R.A., Vejborg, R.M., Bhosale, S., Vocadlo, D., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-12-19 |
|
