| PDBID: | 9iwn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9iw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of apo AsfvPrimPol with dodecamer | | Authors: | Xu, K.E., Chen, Y.T. | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9iw2 | | Status: | HPUB -- hold until publication | | Title: | Chikungunya virus E protein complexed with C37 Fab | | Authors: | Qi, J., Han, X., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwg | | Status: | HPUB -- hold until publication | | Title: | crystal structure of xanthine-II ML2/3 in complex with xanthine | | Authors: | Xu, X.C., Ren, A.M. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iw9 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of KbPETase | | Authors: | Wu, B.H. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Full-Length AsfvPrimPol in DNA-Binding Complex Form | | Authors: | Xu, K.E., Chen, Y.T. | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
| PDBID: | 9g91 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g99 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Joint neutron and x-ray structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g98 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Joint neutron structure of alginate lyase PsAlg7C soaked with pentamannuronic acid | | Authors: | Wilkens, C., Meilleur, F., Morth, J.P. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g97 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8u | | Status: | HPUB -- hold until publication | | Title: | Structure of the LipA:LipB complex from Acinetobacter baumannii | | Authors: | de Oliveira Silva, Y.R., Contreras-Martel, C., Rodrigues de Melo, R., Zanphorlin, L., Trindade, D.M., Dessen, A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g93 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoET structure of the in vitro grown Bacillus anthracis Sap S-layer | | Authors: | Sogues, A., Leigh, K., Van der Verren, S., Kudryashev, M., Pak, A., Halingstad, E.V., Cecil, A.J., Fioravanti, A., Remaut, H. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g95 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g92 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""in"" conformation | | Authors: | Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F. | | Deposition date: | 2024-07-24 |
|
