| PDBID: | 9d34 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1 FIP200 interacting peptide | | Authors: | Radford, K.M., Rosencrans, W., Chou, T.F. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d37 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d39 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d32 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the HKU5 RBD bound to the P. abramus ACE2 receptor | | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KPC-2 complexed with compound 13 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d2x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SpiD ETS-domain (168-273) in complex with the DNA sequence d(AATAAAAGGAAGTGGG) | | Authors: | Terrell, J.R., Vernon, T.N., Poon, G.M.K. | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d33 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-09 |
|
| PDBID: | 9d3f | | Status: | HPUB -- hold until publication | | Title: | Water and chloride as allosteric inhibitors in WNK kinase osmosensing | | Authors: | Akella, R., Goldsmith, E.J. | | Deposition date: | 2024-08-09 | | Sequence: | >Entity 1
QEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQERKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEET
|
|
| PDBID: | 9gf1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-08 |
|
| PDBID: | 9gez | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""waiting"" position | | Authors: | Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F. | | Deposition date: | 2024-08-08 |
|
