| PDBID: | 9jg3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jg0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jft | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfr | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Resembled the partial R-loop state with the PAM-distal spacer forming a base-pair interaction with the TS | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Areconstituted LaTraC ternary complex with a full R-loop | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Areconstituted LaTraC ternary complex with a full R-loop | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jg1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Adriforant-bound Histamine receptor 4 H4R at inactive state | | Authors: | Jin, S.S., Zhang, H., Jiang, Y. | | Deposition date: | 2024-09-05 | | Release date: | 2025-09-05 |
|
| PDBID: | 9jfn | | Status: | HPUB -- hold until publication | | Title: | Arginine decarboxylase in Aspergillus oryzae complexed with agmatine | | Authors: | Mikami, B., Yaukawa, K., Fujiwara, S., Takita, T., Mizutani, K., Odagaki, Y., Murakami, Y. | | Deposition date: | 2024-09-05 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMQSVRIIPTYIERAPGAPATGSSLHSHGHWMPENVELRRAWLSSLLDKTKAEIPRKLRDNVENPVETFRKLIENDSTLYMLAHSMFDEVPEKAPYDRDPTTLKKQVRNYKTMLYLFNTLLTEVPEYFLRDNPNVPSGLIGFPFNIIVDWPMGTPSGRQFFLDTRVNKCLKDILNKWNEFLKDPTAQGNGNKGGNQALIDAGWSSDAAVEQLVNKANESTTDKKKTFSEIFQHPANGTQENFFNYACWDNFFTRRFKDGVRPVADAAVVNACESFPLSFDTDVSRRNTFWLKGTPYSLHDMLGATQDERVASYVDGFVGGSVYQAFLSADSYHCWNAPVTGKVVYRSLIDGTYFAETAAAGFGGSNGPDPAGPDVSQRYITHIAARGVLIVDTNVTGGAKIGLVGFVPVGMSEVSTCDWFDNTEEGKTISKGDVIGAFHSGGS
>Entity 2
THCLIFQRDAVKKLQFIPKAQYPEIATTNLAVNSELAKLTS
|
|
| PDBID: | 9jg2 | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs | | Authors: | Dong, H., Shen, C., Tang, X., Qiao, W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jg4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 | | Release date: | 2025-09-05 |
|
| PDBID: | 9jg5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 | | Release date: | 2025-09-05 |
|
| PDBID: | 9di3 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9dif | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9dhl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray crystal structure of AmpC beta-lactamase with inhibitor | | Authors: | Liu, F., Shoichet, B.K. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dhx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human Argonaute2 -miR-122 in complex with a fully complementary target | | Authors: | Sarkar, S., Gebert, L.F.R., MacRae, I.J. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dhy | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 spike in complex with antibody Fab COVIC-154 | | Authors: | Yu, X., Saphire, E.O. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dhw | | Status: | PROC -- to be processed | | Title: | Q23.MD39 in Complex with Fabs from antibodies CH01 iGL and 35O22 | | Authors: | Lin, Z.J., Cui, J., Du, J., Habib, R., Kulp, D., Pallesen, J. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dhm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of PIsnA complexed with an isonitrile product | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9di2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the USP1-UAF1-Ubiquitin-VS complex | | Authors: | Griffith, J.P. | | Deposition date: | 2024-09-04 | | Release date: | 2024-10-02 |
|
