| PDBID: | 8x26 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x29 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x24 | | Status: | HPUB -- hold until publication | | Title: | anti-CRISPR protein-AcrIF25 | | Authors: | Wang, J.J. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x2m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the IR/IGF-I complex, conformation 2 | | Authors: | Xi, Z. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8x1j | | Status: | HPUB -- hold until publication | | Title: | Study on the Mechanism of Dye Decolorizing Peroxidase Degradation of PVC | | Authors: | Zhang, Z., Yanng, D. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKEANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
>Entity 2
SQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFMLRFTKPVTGGYYFAPSLERIQAL
|
|
| PDBID: | 8x1t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r2y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r32 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the GluK2 ligand-binding domain in complex with L-glutamate and BPAM344 at 1.60 A resolution | | Authors: | Bay, Y., Jeppesen, M.E., Frydenvang, K., Kastrup, J.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r39 | | Status: | HPUB -- hold until publication | | Title: | Full-length LpMIP mutant Y16F | | Authors: | Whittaker, J.J., Guskov, A. | | Deposition date: | 2023-11-08 |
|
