| PDBID: | 9csk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9cst | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTSGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9csu | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTYGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9csv | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-S112Y-K121A bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor, oxidized by hydrogen peroxide | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTYGTTEANAWASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9csw | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-E101Q-S112A-K121Y bound to Cu(II)-biotin-ethyl-dipicolylamine cofactor | | Authors: | Uyeda, K.S., Follmer, A.H., Borovik, A.S. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAQARINTQWLLTAGTTEANAWYSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
|
|
| PDBID: | 9ct6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ctb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 spike protein Ecto-domain with internal tag, All RBD down conformation, State-3 | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ctd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRED mutant-Y199A/N149L | | Authors: | Xu, H., Zhang, Z., Zhang, Y., Xu, Y., Zhang, L. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KRED mutant-Y199A/N149L | | Authors: | Xu, H., Zhang, Z., Zhang, Y., Xu, Y., Zhang, L. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9iw1 | | Status: | HPUB -- hold until publication | | Title: | wild type NMN/NaMN adenylyltransferase from Chaetomium thermophilum | | Authors: | Qian, X.-L., Zheng, Y.-C., Chen, C., Xu, J.-H. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ang1 receptor-binding domain | | Authors: | Wang, R., Huang, M.D., Jiang, L.G. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivu | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of Ang1-A451D receptor binding domain | | Authors: | Wang, R., Huang, M.D., Jiang, L.G. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human secretory glutaminyl cyclase in complex with the inhibitor 3-((2-(1H-imidazol-5-yl)ethyl)carbamoyl)-4-amino-1,2,5-oxadiazole 2-oxide | | Authors: | Li, G.-B., Yu, J.-L., Zhou, C., Ning, X.-L., Mou, J., Wu, J.-W., Meng, F.-B. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9iw0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ct0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9ivz | | Status: | HPUB -- hold until publication | | Title: | Apg mutant enzyme D448A of acarbose hydrolase from human gut flora K. grimontii TD1, complex with acarbose | | Authors: | Zhou, J.H., Huang, J.Y. | | Deposition date: | 2024-07-24 |
|
