| PDBID: | 8qz5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Tyr244Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-10-26 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH(OCS)KKLSSWVLLMKFLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
| PDBID: | 8qyx | | Status: | HPUB -- hold until publication | | Title: | Human 60S ribosomal subunit | | Authors: | Wiechert, F., Schacherl, M., Sprink, T. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qzb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qza | | Status: | HPUB -- hold until publication | | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qz6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyh | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB ZorA E86A_E89A, Calcium binding site mutation | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyk | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_359-592, ZorA tail middle deletion. | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyy | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_435-729, ZorA tail tip deletion. | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qz7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8urt | | Status: | HPUB -- hold until publication | | Title: | Membrane protein enzyme with a specific inhibitor | | Authors: | Roberts, J.R., Maeda, S., Ohi, M.D. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8urp | | Status: | HPUB -- hold until publication | | Title: | Membrane protein enzyme in state 2 | | Authors: | Roberts, J.R., Maeda, S., Ohi, M.D. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8urs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8urr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8urm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 | | Release date: | 2025-05-16 |
|
| PDBID: | 8uro | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1-Fc fragment (E382S) in complex with Corynebacterial ENGase CU43 (D187A-E189A) | | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8urj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 | | Release date: | 2025-04-30 |
|
| PDBID: | 8wwq | | Status: | HPUB -- hold until publication | | Title: | geniposidic acid O-methyltransferase complexed with SAH and geniposidic acid | | Authors: | Luo, Z., Li, L., Ma, D., Zhou, H. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qy8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8qy7 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD apo form | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyc | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyd | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8urg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ura | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Corynebacterium ulcerans endo-beta-N-acetylglucosaminidase catalytically inactive CU43 D187A-E189A at 2.6 A resolution (space group P21) | | Authors: | Sastre, D.E., Sultana, N., Sundberg, E.J. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
